RPL24/RLP24 Antibody

Name	RPL24/RLP24 Antibody
Supplier	Novus Biologicals
Catalog	NBP2-38971
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB ICC/IF IHC IHC-P
Species Reactivities	Human, Rat
Antigen	This antibody was developed against a recombinant protein corresponding to amino acids: QRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIH
Purity/Format	Immunogen affinity purified
Blocking Peptide	RPL24/RLP24 Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	RSL24D1
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: RPL24/RLP24 Antibody [NBP2-38971] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Immunocytochemistry/Immunofluorescence: RPL24/RLP24 Antibody [NBP2-38971] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.

Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971] - Staining of human cerebellum shows moderate nucleoli positivity in Purkinje cells.