ATP6V1B1 Antibody
| Name | ATP6V1B1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33962 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ATP6V1B1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ATP6V1B1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ATP6V1B1 Antibody [NBP2-33962] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25334_ATP6V1B1%2520Antibody-Western%2520Blot-NBP2-33962-img0004.jpg)
Western Blot: ATP6V1B1 Antibody [NBP2-33962] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25335_ATP6V1B1-Antibody-Immunohistochemistry-Paraffin-NBP2-33962-img0001.jpg)
Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.