HIVEP2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-33771
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: IQPTSYMTSKHLPEQPHLFPHQETIPFSPIQNALFQFQYPTVCMVHLPAQQPPWWQAHFPHPFAQHPQKSYGKPSFQTEIHSSYP
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: HIVEP2 Protein
• Description: Rabbit Polyclonal
• Gene: HIVEP2

Product images

Immunocytochemistry/Immunofluorescence: HIVEP2 Antibody [NBP2-33771] - Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.

Immunohistochemistry-Paraffin: HIVEP2 Antibody [NBP2-33771] - cerebellum

Immunohistochemistry-Paraffin: HIVEP2 Antibody [NBP2-33771] - Immunohistochemical staining of human cerebellum shows moderate cytoplasmic and nuclear positivity in Purkinje cells.

Immunohistochemistry-Paraffin: HIVEP2 Antibody [NBP2-33771] - liver cancer