BCAT2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-33705
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHML
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: BCAT2 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: BCAT2
• Conjugate: Unconjugated

Product images

Western Blot: BCAT2 Antibody [NBP2-33705] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: BCAT2 Antibody [NBP2-33705] - Staining of liver cancer.

Immunohistochemistry-Paraffin: BCAT2 Antibody [NBP2-33705] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: BCAT2 Antibody [NBP2-33705] - Staining of tonsil.