ZNF655 Antibody
| Name | ZNF655 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80625 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:TDDNDKYDMSFNQNSASGKHEHLNLTEDFQSSECKESLMDLSHLNKWESIPNTEKSYKCDVCGKIFHQSSALTRHQRI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF655 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZNF655 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ZNF655 Antibody [NBP1-80625] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-663](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17492_ZNF655-Antibody-Western-Blot-NBP1-80625-img0006.jpg)
Western Blot: ZNF655 Antibody [NBP1-80625] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-663
![Immunocytochemistry/Immunofluorescence: ZNF655 Antibody [NBP1-80625] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17493_ZNF655%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80625-img0008.jpg)
Immunocytochemistry/Immunofluorescence: ZNF655 Antibody [NBP1-80625] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & plasma membrane.
![Immunohistochemistry-Paraffin: ZNF655 Antibody [NBP1-80625] - Staining of human esophagus shows nuclear and cytoplasmic positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17494_ZNF655-Antibody-Immunohistochemistry-Paraffin-NBP1-80625-img0007.jpg)
Immunohistochemistry-Paraffin: ZNF655 Antibody [NBP1-80625] - Staining of human esophagus shows nuclear and cytoplasmic positivity in squamous epithelial cells.