ALDH3B1 Antibody
| Name | ALDH3B1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32638 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: AAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ALDH3B1 Protein |
| Description | Rabbit Polyclonal |
| Gene | ALDH3B1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ALDH3B1 Antibody [NBP2-32638] - Staining of human kidney shows strong membranous positivity in cells of tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20017_ALDH3B1-Antibody-Immunohistochemistry-NBP2-32638-img0004.jpg)
Immunohistochemistry: ALDH3B1 Antibody [NBP2-32638] - Staining of human kidney shows strong membranous positivity in cells of tubules.