ATP6V0D2 Antibody
| Name | ATP6V0D2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32388 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LANHTNPLTVSKIDTEMRKRLCGEFEYFRNHSLEPLSTFLTYMTCSYMIDN |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ATP6V0D2 |
| Supplier Page | Shop |
Product images
![Western Blot: ATP6V0D2 Antibody [NBP2-32388] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19545_ATP6V0D2%2520Antibody-Western%2520Blot-NBP2-32388-img0004.jpg)
Western Blot: ATP6V0D2 Antibody [NBP2-32388] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
![Immunohistochemistry: ATP6V0D2 Antibody [NBP2-32388] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19546_ATP6V0D2-Antibody-Immunohistochemistry-NBP2-32388-img0003.jpg)
Immunohistochemistry: ATP6V0D2 Antibody [NBP2-32388] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
![Western Blot: ATP6V0D2 Antibody [NBP2-32388] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19547_ATP6V0D2-Antibody-Western-Blot-NBP2-32388-img0002.jpg)
Western Blot: ATP6V0D2 Antibody [NBP2-32388] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
![Immunohistochemistry: ATP6V0D2 Antibody [NBP2-32388] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19548_ATP6V0D2-Antibody-Immunohistochemistry-NBP2-32388-img0001.jpg)
Immunohistochemistry: ATP6V0D2 Antibody [NBP2-32388] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.