NUPL2 Antibody
| Name | NUPL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31884 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RCWNEHPGARGAGGGRQQPQQQPSGNNRRGWNTTSQRYSNVIQPSSFSKSTPWGGSRDQEKPYFSSFDSGASTNRKEGFGLSENPF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NUPL2 Protein |
| Description | Rabbit Polyclonal |
| Gene | NUPL2 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: NUPL2 Antibody [NBP2-31884] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19674_NUPL2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31884-img0003.jpg)
Immunocytochemistry/Immunofluorescence: NUPL2 Antibody [NBP2-31884] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
![Immunohistochemistry: NUPL2 Antibody [NBP2-31884] - Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19675_NUPL2%2520Antibody-Immunohistochemistry-NBP2-31884-img0004.jpg)
Immunohistochemistry: NUPL2 Antibody [NBP2-31884] - Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
![Immunocytochemistry/Immunofluorescence: NUPL2 Antibody [NBP2-31884] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19676_NUPL2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31884-img0001.jpg)
Immunocytochemistry/Immunofluorescence: NUPL2 Antibody [NBP2-31884] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
![Immunohistochemistry: NUPL2 Antibody [NBP2-31884] - Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/19677_NUPL2-Antibody-Immunohistochemistry-NBP2-31884-img0002.jpg)
Immunohistochemistry: NUPL2 Antibody [NBP2-31884] - Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.