ATP6V1B2 Antibody
| Name | ATP6V1B2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88890 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ATP6V1B2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ATP6V1B2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ATP6V1B2 Antibody [NBP1-88890] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21874_ATP6V1B2-Antibody-Western-Blot-NBP1-88890-img0006.jpg)
Western Blot: ATP6V1B2 Antibody [NBP1-88890] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
![Immunocytochemistry/Immunofluorescence: ATP6V1B2 Antibody [NBP1-88890] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21875_ATP6V1B2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88890-img0007.jpg)
Immunocytochemistry/Immunofluorescence: ATP6V1B2 Antibody [NBP1-88890] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
![Immunohistochemistry-Paraffin: ATP6V1B2 Antibody [NBP1-88890] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21876_ATP6V1B2-Antibody-Immunohistochemistry-Paraffin-NBP1-88890-img0001.jpg)
Immunohistochemistry-Paraffin: ATP6V1B2 Antibody [NBP1-88890] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
![Western Blot: ATP6V1B2 Antibody [NBP1-88890] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21877_ATP6V1B2-Antibody-Western-Blot-NBP1-88890-img0005.jpg)
Western Blot: ATP6V1B2 Antibody [NBP1-88890] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
![Immunocytochemistry/Immunofluorescence: ATP6V1B2 Antibody [NBP1-88890] - Staining of human cell line U-251MG shows positivity in golgi apparatus and vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21878_ATP6V1B2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88890-img0004.jpg)
Immunocytochemistry/Immunofluorescence: ATP6V1B2 Antibody [NBP1-88890] - Staining of human cell line U-251MG shows positivity in golgi apparatus and vesicles.