ACCN4 Antibody
| Name | ACCN4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88860 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:CNINRFRHSALSDADIFHLANLTGLPPKDRDGHRAAGLRYPEPDMVDILNRTGHQLADMLKSCNFSGHHCSASNFSVVYT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ACCN4 Protein |
| Description | Rabbit Polyclonal |
| Gene | ASIC4 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: ACCN4 Antibody [NBP1-88860] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/21444_ACCN4-Antibody-Immunohistochemistry-Paraffin-NBP1-88860-img0002.jpg)
Immunohistochemistry-Paraffin: ACCN4 Antibody [NBP1-88860] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.
![Western Blot: ACCN4 Antibody [NBP1-88860] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/29069_ACCN4-Antibody-Western-Blot-NBP1-88860-img0006.jpg)
Western Blot: ACCN4 Antibody [NBP1-88860] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
![Immunofluorescence: ACCN4 Antibody [NBP1-88860] - Staining of human cell line A-431 shows positivity in golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/29070_ACCN4-Antibody-Immunofluorescence-NBP1-88860-img0007.jpg)
Immunofluorescence: ACCN4 Antibody [NBP1-88860] - Staining of human cell line A-431 shows positivity in golgi apparatus.