NT5C Antibody

Name NT5C Antibody
Supplier Novus Biologicals
Catalog NBP1-84564
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:GALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVL
Purity/Format Immunogen affinity purified
Blocking Peptide NT5C Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene NT5C
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.