NT5C Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-84563
• Prices: $129.00, $419.00
• Sizes: 25 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB Simple Western ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:VLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIP
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: NT5C Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: NT5C
• Conjugate: Unconjugated

Product images

Immunocytochemistry/Immunofluorescence: NT5C Antibody [NBP1-84563] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: NT5C Antibody [NBP1-84563] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Simple Western: NT5C Antibody [NBP1-84563] - Simple Western lane view shows a specific band for NT5C in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: NT5C Antibody [NBP1-84563] - Simple Western lane view shows a specific band for NT5C in 0.2 mg/ml of U-2OS lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: NT5C Antibody [NBP1-84563] - Electropherogram image(s) of corresponding Simple Western lane view. NT5C antibody was used at 1:20 dilution on U-2OS lysates(s).