PGM1 Antibody
| Name | PGM1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85977 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SILATRKQSVEDILKDHWQKHGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PGM1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PGM1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PGM1 Antibody [NBP1-85977] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-425](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13880_PGM1-Antibody-Western-Blot-NBP1-85977-img0006.jpg)
Western Blot: PGM1 Antibody [NBP1-85977] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-425
![Immunocytochemistry/Immunofluorescence: PGM1 Antibody [NBP1-85977] - Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13881_PGM1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85977-img0007.jpg)
Immunocytochemistry/Immunofluorescence: PGM1 Antibody [NBP1-85977] - Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments.
![Immunohistochemistry-Paraffin: PGM1 Antibody [NBP1-85977] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13882_PGM1-Antibody-Immunohistochemistry-Paraffin-NBP1-85977-img0002.jpg)
Immunohistochemistry-Paraffin: PGM1 Antibody [NBP1-85977] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.