COQ6 Antibody
| Name | COQ6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13860 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: NRVSSISPGSATLLSSFGAWDHICNMRYRAFRRMQVWDACSEALIMFDKD NLDDMGYIVENDVIMHALTKQLE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | COQ6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | COQ6 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: COQ6 Antibody [NBP2-13860] - Staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/24058_COQ6-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13860-img0003.jpg)
Immunocytochemistry/Immunofluorescence: COQ6 Antibody [NBP2-13860] - Staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: COQ6 Antibody [NBP2-13860] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/24059_COQ6-Antibody-Immunohistochemistry-Paraffin-NBP2-13860-img0001.jpg)
Immunohistochemistry-Paraffin: COQ6 Antibody [NBP2-13860] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
![Western Blot: COQ6 Antibody [NBP2-13860] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/29275_COQ6-Antibody-Western-Blot-NBP2-13860-img0005.jpg)
Western Blot: COQ6 Antibody [NBP2-13860] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp