ZNF707 Antibody
| Name | ZNF707 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92642 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QWEEPWVEDRERPEFQAVQRGPRPGARKSADPKRHCDHPAWAHKKTHVRRERAREGSSFRKGFRLDTDDGQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF707 Protein |
| Description | Rabbit Polyclonal |
| Gene | ZNF707 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: ZNF707 Antibody [NBP1-92642] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/25478_ZNF707-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92642-img0004.jpg)
![Immunohistochemistry-Paraffin: ZNF707 Antibody [NBP1-92642] - Staining of human stomach, upper shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/25479_ZNF707-Antibody-Immunohistochemistry-Paraffin-NBP1-92642-img0002.jpg)