FECH Antibody
| Name | FECH Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54840 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to FECH(ferrochelatase (protoporphyria)) The peptide sequence was selected from the N terminal of FECH. Peptide sequence LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | FECH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: FECH Antibody [NBP1-54840] - Mouse liver, heart and brain mitochondria extract, concentration 2 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19477_FECH-Antibody-Western-Blot-NBP1-54840-img0002.jpg)
![Western Blot: FECH Antibody [NBP1-54840] - Jurkat cell lysate, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19478_FECH-Antibody-Western-Blot-NBP1-54840-img0001.jpg)