Rab5b Antibody
| Name | Rab5b Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58938 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RAB5B(RAB5B, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB5B. Peptide sequence MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RAB5B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Rab5b Antibody [NBP1-58938] - Human placenta tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4064_Rab5b-Antibody-Western-Blot-NBP1-58938-img0001.jpg)
Western Blot: Rab5b Antibody [NBP1-58938] - Human placenta tissue lysate at a concentration of 1ug/ml.
![Immunohistochemistry-Paraffin: Rab5b Antibody [NBP1-58938] - Sample type: zebra gut epithelial cells, Green: primary, Red: actin, Blue : DAPI, Primary dilution : 1:5000, Secondary Dilution : 1:300, Image Submitted by: Michel Bagnat, Duke University Medical Center See Customer Feedback tab for detailed information.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4065_Rab5b-Antibody-Immunohistochemistry-Paraffin-NBP1-58938-img0003.jpg)
Immunohistochemistry-Paraffin: Rab5b Antibody [NBP1-58938] - Sample type: zebra gut epithelial cells, Green: primary, Red: actin, Blue : DAPI, Primary dilution : 1:5000, Secondary Dilution : 1:300, Image Submitted by: Michel Bagnat, Duke University Medical Center See Customer Feedback tab for detailed information.