ADTB1 Antibody
| Name | ADTB1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-68947 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | Synthetic peptides corresponding to AP1B1 (adaptor-related protein complex 1, beta 1 subunit) The peptide sequence was selected from the C terminal of AP1B1. Peptide sequence KLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | AP1B1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ADTB1 Antibody [NBP1-68947] - ADTB1 Antibody Mouse WT brain and Rat brain, concentration 2ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24284_ADTB1-Antibody-Western-Blot-NBP1-68947-img0004.jpg)
![Western Blot: ADTB1 Antibody [NBP1-68947] - ADTB1 Antibody Human Muscle lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24285_ADTB1-Antibody-Western-Blot-NBP1-68947-img0003.jpg)