ALLC Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-32700
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: GVCVGFSNAKFGHPNNIIGVGGAKSMADGWETARRLDRPPILENDENGILLVPGCEWAVFRLAHPGVITRIEIDTKYFEGNAPDSCKVDGC
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: ALLC Protein
• Description: Rabbit Polyclonal
• Gene: ALLC

Product images

Immunohistochemistry: ALLC Antibody [NBP2-32700] - pancreas

Immunohistochemistry: ALLC Antibody [NBP2-32700] - Immunohistochemical staining of human uterus, post-menopause, shows strong cytoplasmic and membranous staining.

Immunohistochemistry: ALLC Antibody [NBP2-32700] - Immunohistochemical staining of human uterus, post-menopause, shows strong cytoplasmic and membranous staining.

Immunohistochemistry: ALLC Antibody [NBP2-32700] - liver cancer