Adenylate Cyclase 8 Antibody

Name Adenylate Cyclase 8 Antibody
Supplier Novus Biologicals
Catalog NBP1-59027
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ADCY8(adenylate cyclase 8 (brain)) The peptide sequence was selected from the middle region of ADCY8 (NP_001106). Peptide sequence EIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ADCY8
Conjugate Unconjugated
Supplier Page Shop

Product images