IQCK Antibody

Name IQCK Antibody
Supplier Novus Biologicals
Catalog NBP1-56735
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to IQCK(IQ motif containing K) The peptide sequence was selected from the middle region of IQCK. Peptide sequence GMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene IQCK
Conjugate Unconjugated
Supplier Page Shop

Product images