ATP6AP1 Antibody

Name ATP6AP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57020
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ATP6AP1 (ATPase, H+ transporting, lysosomal accessory protein 1) The peptide sequence was selected from the middle region of ATP6AP1. Peptide sequence SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ATP6AP1
Conjugate Unconjugated
Supplier Page Shop

Product images