Blood group H inhibitor Antibody

Name Blood group H inhibitor Antibody
Supplier Novus Biologicals
Catalog NBP1-57016
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FUT1 (fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)) The peptide sequence was selected from the middle region of FUT1 (NP_000139). Peptide sequence EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGG
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FUT1
Conjugate Unconjugated
Supplier Page Shop

Product images