DYNC1I2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56998
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to DYNC1I2 (dynein, cytoplasmic 1, intermediate chain 2) The peptide sequence was selected from the N terminal of DYNC1I2. Peptide sequence VAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDH.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: DYNC1I2
• Conjugate: Unconjugated