FADS1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-60083
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to FADS1(fatty acid desaturase 1) The peptide sequence was selected from the N terminal of FADS1. Peptide sequence RHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPSF.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: FADS1
• Conjugate: Unconjugated

Product images

Western Blot: FADS1 Antibody [NBP1-60083] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.