Wnt-2 Antibody

Name Wnt-2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57938
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to WNT2(wingless-type MMTV integration site family member 2) The peptide sequence was selected from the middle region of WNT2. Peptide sequence GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene WNT2
Conjugate Unconjugated
Supplier Page Shop

Product images