glycerol-3-phosphate permease Antibody
| Name | glycerol-3-phosphate permease Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69300 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC37A1(solute carrier family 37 (glycerol-3-phosphate transporter), member 1) The peptide sequence was selected from the middle region of SLC37A1 (NP_061837). Peptide sequence LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLD |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC37A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: glycerol-3-phosphate permease Antibody [NBP1-69300] - This Anti-SLC37A1 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14887_glycerol-3-phosphate%2520permease%2520Antibody-Western%2520Blot-NBP1-69300-img0001.jpg)
Western Blot: glycerol-3-phosphate permease Antibody [NBP1-69300] - This Anti-SLC37A1 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.