Carbonic Anhydrase VII/CA7 Antibody

Name Carbonic Anhydrase VII/CA7 Antibody
Supplier Novus Biologicals
Catalog NBP1-68888
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CA7 (carbonic anhydrase VII) The peptide sequence was selected from the C terminal of CA7. Peptide sequence SLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CA7
Conjugate Unconjugated
Supplier Page Shop

Product images