Name | FA2H Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-68928 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Antigen | Synthetic peptides corresponding to Fa2h (fatty acid 2-hydroxylase) The peptide sequence was selected from the C terminal of Fa2h. Peptide sequence HGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGIIFAGGLL. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | Fa2h |
Conjugate | Unconjugated |
Supplier Page | Shop |