FA2H Antibody

Name FA2H Antibody
Supplier Novus Biologicals
Catalog NBP1-68928
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptides corresponding to Fa2h (fatty acid 2-hydroxylase) The peptide sequence was selected from the C terminal of Fa2h. Peptide sequence HGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGIIFAGGLL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Fa2h
Conjugate Unconjugated
Supplier Page Shop

Product images