Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody

Name Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody
Supplier Novus Biologicals
Catalog NBP1-68917
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Rat
Antigen Synthetic peptides corresponding to Gns (glucosamine (N-acetyl)-6-sulfatase) The peptide sequence was selected from the C terminal of Gns. Peptide sequence YIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GNS
Conjugate Unconjugated
Supplier Page Shop

Product images