RhoG Antibody
| Name | RhoG Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79794 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human RHOGThe immunogen for this antibody is RHOG. Peptide sequence LVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RHOG |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RhoG Antibody [NBP1-79794] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24865_RhoG-Antibody-Western-Blot-NBP1-79794-img0002.jpg)
Western Blot: RhoG Antibody [NBP1-79794] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
![Immunohistochemistry: RhoG Antibody [NBP1-79794] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Plasma membrane in intercalated disk Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24866_RhoG-Antibody-Immunohistochemistry-NBP1-79794-img0003.jpg)
Immunohistochemistry: RhoG Antibody [NBP1-79794] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Plasma membrane in intercalated disk Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec