ACP2 Antibody
| Name | ACP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-74241 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Rat |
| Antigen | Synthetic peptides corresponding to the middle region of Acp2. Immunizing peptide sequence GQALRQRYHGFLNASYHRQEVYVRSTDFDRTLMSAEANLAGLFPPTEVQH. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ACP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ACP2 Antibody [NBP1-74241] - Mouse Kidney Lysate, Antibody Titration is 1 ug/ml and Gel concentration used is 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/12684_ACP2%2520Antibody-Western%2520Blot-NBP1-74241-img0001.jpg)
Western Blot: ACP2 Antibody [NBP1-74241] - Mouse Kidney Lysate, Antibody Titration is 1 ug/ml and Gel concentration used is 12%