CDS1 Antibody

Name CDS1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59495
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CDS1(CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1) The peptide sequence was selected from the middle region of CDS1. Peptide sequence VVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSL
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CDS1
Conjugate Unconjugated
Supplier Page Shop

Product images