GAS8 Antibody
| Name | GAS8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55508 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GAS8(growth arrest-specific 8) The peptide sequence was selected from the middle region of GAS8. Peptide sequence RALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GAS8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GAS8 Antibody [NBP1-55508] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24184_GAS8-Antibody-Western-Blot-NBP1-55508-img0003.jpg)
Western Blot: GAS8 Antibody [NBP1-55508] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.
![Immunocytochemistry/Immunofluorescence: GAS8 Antibody [NBP1-55508] - Application: IHCSpecies+tissue/cell type: Species+tissue/cell type: Human nasal epithelial cells Primary Antibody dilution: 1 : 1200 Secondary Antibody: Goat anti-rabbit Alexa Fluor 546 Secondary Antibody dilution: 1 : 1000 - See more at: //www. avi](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24185_GAS8%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-55508-img0004.jpg)
Immunocytochemistry/Immunofluorescence: GAS8 Antibody [NBP1-55508] - Application: IHCSpecies+tissue/cell type: Species+tissue/cell type: Human nasal epithelial cells Primary Antibody dilution: 1 : 1200 Secondary Antibody: Goat anti-rabbit Alexa Fluor 546 Secondary Antibody dilution: 1 : 1000 - See more at: //www. avi