12-Lipoxygenase Antibody
| Name | 12-Lipoxygenase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56327 |
| Prices | $329.00 |
| Sizes | 50 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ALOX12(arachidonate 12-lipoxygenase) The peptide sequence was selected from the C terminal of ALOX12. Peptide sequence MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ALOX12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: 12-Lipoxygenase Antibody [NBP1-56327] - Human Brain lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14716_12-Lipoxygenase%2520Antibody-Western%2520Blot-NBP1-56327-img0002.jpg)
Western Blot: 12-Lipoxygenase Antibody [NBP1-56327] - Human Brain lysate, concentration 0.2-1 ug/ml.