ACBD7 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56527
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to ACBD7(acyl-Coenzyme A binding domain containing 7) The peptide sequence was selected from the N terminal of ACBD7 (NP_001034933). Peptide sequence MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLD.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ACBD7
• Conjugate: Unconjugated

Product images

Western Blot: ACBD7 Antibody [NBP1-56527] - Human Brain lysate, concentration 0.2-1 ug/ml.

Immunocytochemistry/Immunofluorescence: ACBD7 Antibody [NBP1-56527] - Analysis of ACBD7 in 3T3-L1 cells using ACBD7 antibody. Image from verified customer review.

Immunohistochemistry-Paraffin: ACBD7 Antibody [NBP1-56527] - Mouse arcuate nucleus stained with ACBD7 (brown) and GFAP (black) antibodies. Image from verified customer review.

Immunofluorescence: ACBD7 Antibody [NBP1-56527] - Mouse arcuate nucleus stained with ACBD7 antibody. Image from verified customer review.