ALAD Antibody
| Name | ALAD Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56508 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ALAD(aminolevulinate, delta-, dehydratase) The peptide sequence was selected from the middle region of ALAD. Peptide sequence SVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ALAD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ALAD Antibody [NBP1-56508] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: Jurkat cell lysate ALAD is supported by BioGPS gene expression data to be expressed in Jurkat](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24567_ALAD%2520Antibody-Western%2520Blot-NBP1-56508-img0004.jpg)
Western Blot: ALAD Antibody [NBP1-56508] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: Jurkat cell lysate ALAD is supported by BioGPS gene expression data to be expressed in Jurkat
![Immunohistochemistry: ALAD Antibody [NBP1-56508] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24568_ALAD-Antibody-Immunohistochemistry-NBP1-56508-img0003.jpg)
Immunohistochemistry: ALAD Antibody [NBP1-56508] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec