Glycogen synthase 2 Antibody
| Name | Glycogen synthase 2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55133 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GYS2(glycogen synthase 2 (liver)) The peptide sequence was selected from the middle region of GYS2. Peptide sequence TLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVED. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GYS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Glycogen synthase 2 Antibody [NBP1-55133] - Human Muscle lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7272_Glycogen-synthase-2-Antibody-Western-Blot-NBP1-55133-img0003.jpg)
Western Blot: Glycogen synthase 2 Antibody [NBP1-55133] - Human Muscle lysate, concentration 0.2-1 ug/ml.