ATP5E Antibody (2F3)

• Supplier: Novus Biologicals
• Catalog: H00000514-M01
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone: 2F3
• Applications: WB ELISA IHC-P
• Species Reactivities: Human
• Antigen: ATP5E (AAH01690, 1 a.a. - 51 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: ATP5E
• Conjugate: Unconjugated