ATOX1 Antibody (4D6)

Name ATOX1 Antibody (4D6)
Supplier Novus Biologicals
Catalog H00000475-M08
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG2a Kappa
Clone 4D6
Applications WB ELISA
Species Reactivities Human
Antigen ATOX1 (NP_004036, 1 a.a. - 68 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Purity/Format IgG purified
Description Mouse Monoclonal
Gene ATOX1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.