Cytochrome C Oxidase subunit 6c Antibody (S51)
| Name | Cytochrome C Oxidase subunit 6c Antibody (S51) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001345-M03 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone | S51 |
| Applications | WB ELISA IHC-P |
| Species Reactivities | Human |
| Antigen | COX6C (AAH00187, 1 a.a. - 75 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | COX6C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: Cytochrome C Oxidase subunit 6c Antibody (S51) [H00001345-M03] - Analysis of monoclonal antibody to COX6C on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/8917_Cytochrome-C-Oxidase-subunit-6c-Antibody-(S51)-Immunohistochemistry-Paraffin-H00001345-M03-img0003.jpg)
Immunohistochemistry-Paraffin: Cytochrome C Oxidase subunit 6c Antibody (S51) [H00001345-M03] - Analysis of monoclonal antibody to COX6C on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1 ug/ml
![ELISA: Cytochrome C Oxidase subunit 6c Antibody (S51) [H00001345-M03] - Detection limit for recombinant GST tagged COX6C is approximately 1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/8918_Cytochrome-C-Oxidase-subunit-6c-Antibody-(S51)-ELISA-H00001345-M03-img0002.jpg)
ELISA: Cytochrome C Oxidase subunit 6c Antibody (S51) [H00001345-M03] - Detection limit for recombinant GST tagged COX6C is approximately 1ng/ml as a capture antibody.