Acetoacetyl CoA synthetase Antibody
| Name | Acetoacetyl CoA synthetase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38861 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RVVGYLPNSEHAVEAMLAAASIGAIWSSTSPDFGVNGVLDRFSQIQPKLIFSVEAVVYNGKEHNHMEKLQQVVKGLPDLKKVVVI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Acetoacetyl CoA synthetase Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | AACS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Acetoacetyl CoA synthetase Antibody [NBP2-38861] - Immunofluorescent staining of human cell line MCF7 shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9501_Acetoacetyl%2520CoA%2520synthetase%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38861-img0003.jpg)
Immunocytochemistry/Immunofluorescence: Acetoacetyl CoA synthetase Antibody [NBP2-38861] - Immunofluorescent staining of human cell line MCF7 shows localization to vesicles.
![Immunohistochemistry: Acetoacetyl CoA synthetase Antibody [NBP2-38861] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9502_Acetoacetyl-CoA-synthetase-Antibody-Immunohistochemistry-NBP2-38861-img0002.jpg)
Immunohistochemistry: Acetoacetyl CoA synthetase Antibody [NBP2-38861] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.