NFS1 Antibody
| Name | NFS1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37933 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GVGAIYIRRRPRVRVEALQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYPGCINLSF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NFS1 Protein |
| Description | Rabbit Polyclonal |
| Gene | NFS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: NFS1 Antibody [NBP2-37933] - Staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6722_NFS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37933-img0003.jpg)
![Immunohistochemistry: NFS1 Antibody [NBP2-37933] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6723_NFS1-Antibody-Immunohistochemistry-NBP2-37933-img0002.jpg)