RPL4 Antibody
| Name | RPL4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81329 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:TLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RPL4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RPL4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: RPL4 Antibody [NBP1-81329] - Staining of human cell line A-431 shows localization to nuclear bodies, cytosol & endoplasmic reticulum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6330_RPL4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81329-img0004.jpg)
Immunocytochemistry/Immunofluorescence: RPL4 Antibody [NBP1-81329] - Staining of human cell line A-431 shows localization to nuclear bodies, cytosol & endoplasmic reticulum.
![Immunohistochemistry-Paraffin: RPL4 Antibody [NBP1-81329] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine pancreas.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6331_RPL4-Antibody-Immunohistochemistry-Paraffin-NBP1-81329-img0002.jpg)
Immunohistochemistry-Paraffin: RPL4 Antibody [NBP1-81329] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine pancreas.