ZYG11B Antibody
| Name | ZYG11B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82255 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DATGVNADITITDIISGLGSNKWIQQNLQCLVLNSLTLSLEDPYERCFSRLSGLRALSITNVLFYNEDLAEVASLPRLESLDISNTSI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZYG11B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZYG11B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZYG11B Antibody [NBP1-82255] - Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4533_ZYG11B%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82255-img0006.jpg)
Immunocytochemistry/Immunofluorescence: ZYG11B Antibody [NBP1-82255] - Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments.
![Immunohistochemistry-Paraffin: ZYG11B Antibody [NBP1-82255] - Staining of human kidney shows cytoplasmic positivity in cells of tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4534_ZYG11B-Antibody-Immunohistochemistry-Paraffin-NBP1-82255-img0005.jpg)
Immunohistochemistry-Paraffin: ZYG11B Antibody [NBP1-82255] - Staining of human kidney shows cytoplasmic positivity in cells of tubules.