CLCN2 Antibody
| Name | CLCN2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85585 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CLCN2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CLCN2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: CLCN2 Antibody [NBP1-85585] - Staining of human cell line CACO-2 shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6612_CLCN2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85585-img0005.jpg)
![Immunohistochemistry-Paraffin: CLCN2 Antibody [NBP1-85585] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6613_CLCN2%2520Antibody-Immunohistochemistry-Paraffin-NBP1-85585-img0006.jpg)