SEC61B Antibody
| Name | SEC61B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13290 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: AAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SEC61B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SEC61B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SEC61B Antibody [NBP2-13290] - Immunofluorescent staining of human cell line PC-3 shows localization to endoplasmic reticulum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9309_SEC61B%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13290-img0005.jpg)
Immunocytochemistry/Immunofluorescence: SEC61B Antibody [NBP2-13290] - Immunofluorescent staining of human cell line PC-3 shows localization to endoplasmic reticulum.
![Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9310_SEC61B-Antibody-Immunohistochemistry-Paraffin-NBP2-13290-img0004.jpg)
Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.