DC8 Antibody
| Name | DC8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13678 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: FVQKLGDALPEEIREPALRDAQWTFESAVQENISINGQAWQEASDNCFMD SDIKVLEDQFDEIIVDIATKRKQYP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DC8 Protein |
| Description | Rabbit Polyclonal |
| Gene | NSL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: DC8 Antibody [NBP2-13678] Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli, plasma membrane and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10904_DC8%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13678-img0002.jpg)
Immunocytochemistry/Immunofluorescence: DC8 Antibody [NBP2-13678] Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli, plasma membrane and cytoplasm.
![Immunohistochemistry-Paraffin: DC8 Antibody [NBP2-13678] - Staining of human tonsil shows moderate nuclear positivity in germinal center cells and strong nuclear staining in non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10905_DC8%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13678-img0001.jpg)
Immunohistochemistry-Paraffin: DC8 Antibody [NBP2-13678] - Staining of human tonsil shows moderate nuclear positivity in germinal center cells and strong nuclear staining in non-germinal center cells.