PAPSS1 Antibody
| Name | PAPSS1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13730 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: QERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVL AE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PAPSS1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PAPSS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PAPSS1 Antibody [NBP2-13730] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17275_PAPSS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13730-img0005.jpg)
Immunocytochemistry/Immunofluorescence: PAPSS1 Antibody [NBP2-13730] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
![Immunohistochemistry-Paraffin: PAPSS1 Antibody [NBP2-13730] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17276_PAPSS1%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13730-img0006.jpg)
Immunohistochemistry-Paraffin: PAPSS1 Antibody [NBP2-13730] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.