ENPP-3/CD203c Antibody
| Name | ENPP-3/CD203c Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88928 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P WB |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFEN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ENPP-3/CD203c Protein |
| Description | Rabbit Polyclonal |
| Gene | ENPP3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: ENPP-3/CD203c Antibody [NBP1-88928] - Staining of human uterus shows distinct membranous positivity in glandular cells with extracellular staining.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5815_ENPP-3-CD203c-Antibody-Immunohistochemistry-Paraffin-NBP1-88928-img0002.jpg)
Immunohistochemistry-Paraffin: ENPP-3/CD203c Antibody [NBP1-88928] - Staining of human uterus shows distinct membranous positivity in glandular cells with extracellular staining.